Problem in Fasta.pm /var/www/html/lmd/data/S_cerevisiae/singles_all_data//6324140.fa No such file or directory
The protein with accession 6324140 putatively interact with VKxxxW motif from set of proteins below the red line


 YNL189W 6324140
MDNGTDSSTSKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIPPTDGADSDEE
DESSVSADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMR
ENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDY
VLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWA
ISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLL
SSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDI
IRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQ
QNENDKIYEKAYKIIETYFGEEEDAVDETMAPQNAGNTFGFGSNVNQQFNFN

   Total length: 549
   Features: Pfam:IBB(9-110) ARM(119-160) ARM(162-202) ARM(204-244) ARM(247-286) ARM(288-328) ARM(330-370) ARM(372-412) ARM(417-457)
The proteins below interact with the protein with accession 6324140 (above) and contain the VKxxxW motif.

The proteins below also interact with the protein with accession 6324140 (above) , but do not contain the VK...W motif.