Problem in Fasta.pm /var/www/html/lmd/data/S_cerevisiae/singles_all_data//6324423.fa No such file or directory
The protein with accession 6324423 putatively interact with QxxxQQ motif from set of proteins below the red line


 YOL149W 6324423
MTGAATAAENSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLEYQGVLAIYLR
DVSQNTNLLPVSPQEVDIFDSQNGSNNIQVNNGSDNSNRNSSGNGNSYKSNDSLTYNCGKTLSGKDIYNY
GLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEVYGIWIHTVSD
RQNIYELIKYLLENEPKDSFA

   Total length: 234
   Features: Pfam:DCP1(15-222)
The proteins below interact with the protein with accession 6324423 (above) and contain the QxxxQQ motif.

The proteins below also interact with the protein with accession 6324423 (above) , but do not contain the Q...QQ motif.