Problem in Fasta.pm /var/www/html/lmd/data/S_cerevisiae/singles_all_data//6324931.fa No such file or directory
The protein with accession 6324931 putatively interact with PNxxN motif from set of proteins below the red line


 YOR355W 6324931
MALANSRPLQIPTLENEILHNSNSPVFQLNSMGFTTRADTISNPGTDLIGNQPGMALDDNNLAGSSFSSS
QEIKATKPKKDFGAPKKDNPLLEISKLIPVTGERPKPENRDSPLDDDVLHAVFLILWEMDPNQQGMTVKQ
LCDLLLQKHPDMSNLSTKLSNLISAKLNAYVKKIEKGEKTLTYALSREWSNSSPRRMLYIYRGILSPDYK
EHAQAVTMQLKQQLETSGDTSDFNSNGKKKRESSSNQLVNNDSYSSSMTDMKNMSSNSSFSKNLNVGNLA
FSLSPEFNIPYSTSPVSLNLSPSMSNNQQQLLTPNSASKSKNNNKKRNYMDEDTNESMTEPKKTKTTKPG
KQTKSQSLSVLSTPKKGSSASLSTFASSKNISPDSSLSHNASSNTYVTAAAAAPRLSKLLPKNGFKKNSR
SSSELAAIHKVISTQTPIESSSESSQYNSSSSSPVNSAAASSAESLSDINSSQDNGRESNPSSQESRNEV
TNWMKIVRNGFLTHDIESPESITLDDLENIFN

   Total length: 529
   Features:
The proteins below interact with the protein with accession 6324931 (above) and contain the PNxxN motif.

The proteins below also interact with the protein with accession 6324931 (above) , but do not contain the PN..N motif.