Problem in Fasta.pm /var/www/html/lmd/data/S_cerevisiae/singles_all_data//6323455.fa No such file or directory
The protein with accession 6323455 putatively interact with KASxxxQ motif from set of proteins below the red line


 YLR423C 6323455
MNEADVTKFVNNARKTLTDAQLLCSSANLRIVDIKKKLSSWQLSISKLNFLIVGLRQQGKFLYTILKEGI
GTKLIQKQWNQAVLVVLVDEMKYWQYEITSKVQRLDGIVNELSISEKDDTDPSKLGDYISRDNVNLLNDK
LKEVPVIERQIENIKLQYENMVRKVNKELIDTKLTDVTQKFQSKFGIDNLMETNVAEQFSRELTDLEKDL
AEIMNSLTQHFDKTLLLQDKKIDNDEREELFKVVQGDDKELYNIFKTLHEVIDDVDKTILNLGQFLQAKI
KEKTELHSEVSEIINDFNRNLEYLLIFKDISNLIDSFKNSCTQDIQTTKELCEFYDNFEESYGNLVLEAK
RRKDVANRMKTILKDCEKQLQNLDAQDQEERQNFIAENGTYLPETIWPGKIDDFSSLYTLNYNVKNP

   Total length: 423
   Features: Pfam:APG17(1-417)
The proteins below interact with the protein with accession 6323455 (above) and contain the KASxxxQ motif.

The proteins below also interact with the protein with accession 6323455 (above) , but do not contain the KAS...Q motif.